PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_21440g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 392aa    MW: 43827 Da    PI: 4.9234
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_21440g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.51.7e-141461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+ Ed +l ++++ +G g W+  +++ g++R++k+c++rw++yl
    MA_21440g0010 14 RGAWTKKEDMILSEYIRIHGDGGWRNLPKKAGLKRCGKSCRLRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding49.11.3e-1572112648
                      HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      ++E+el+++++++lG++ W++Ia +++ gRt++++k++w+++l
    MA_21440g0010  72 PDEEELIIRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNTHL 112
                      89***************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-21563IPR009057Homeodomain-like
PROSITE profilePS5129414.909961IPR017930Myb domain
SuperFamilySSF466897.03E-2712108IPR009057Homeodomain-like
SMARTSM007171.5E-111363IPR001005SANT/Myb domain
PfamPF002493.5E-131461IPR001005SANT/Myb domain
CDDcd001673.93E-91661No hitNo description
PROSITE profilePS5129425.31962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2464116IPR009057Homeodomain-like
SMARTSM007173.8E-1466114IPR001005SANT/Myb domain
PfamPF002495.4E-1472112IPR001005SANT/Myb domain
CDDcd001674.61E-1272112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MGRSPCCSKE GLNRGAWTKK EDMILSEYIR IHGDGGWRNL PKKAGLKRCG KSCRLRWLNY  60
LRPDIKRGNI CPDEEELIIR LHRLLGNRWS LIAGRLPGRT DNEIKNYWNT HLSKKLSLNE  120
SQHKTSQNLI SSSKSPFPVQ TRVFKASPFP VQTRVFKATA VKITTAVRHS DIIRPNGYNG  180
DDCSNCTSGK ALKLCDVKET TKSSWRGVPV NDSITNEQSE RIASATTDNL IQTEATNCTS  240
STSNLADQQS PDSDHFAGDA ATLAESLLYL NDLSSPDCNL LPTPSDCSTD FASEELHRGP  300
ASLTEETNGF EDMCCDQSNM PCVNSFTVPD DQEMEEFFNS AQHENWIPEL DCLENSSAQP  360
LSLLLLESED EWEERSISTL LLEDPLQIPQ IP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-241211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6770190.0EF677019.1 Picea sitchensis clone WS02760_D04 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB8LMJ60.0B8LMJ6_PICSI; Putative uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.15e-55myb domain protein 3